PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0926s0073.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 316aa    MW: 34946.9 Da    PI: 6.7824
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0926s0073.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18228262135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C +Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Cagra.0926s0073.1.p 228 CNHCGVQKTPQWRAGPSGAKTLCNACGVRYKSGRL 262
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.0E-9911315IPR016679Transcription factor, GATA, plant
SuperFamilySSF577168.55E-14220284No hitNo description
SMARTSM004011.5E-15222276IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.136222258IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-14226260IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.95E-14227275No hitNo description
PfamPF003201.8E-16228262IPR000679Zinc finger, GATA-type
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MESVVELALK NSNMNEKTLT TGGSLNGEDF SVDDLLDFPN EDDDDVVARV EEDETDLKAQ  60
RKRGPSLEIT LHRSNDFSTP EDFPTSELSV PMDDIAELEW LSNFVEDSFT PYSSAPTKKP  120
VWLTGNRRHP VPSVNEDSCF KAPPPPPVQI RPKRARAGVR VWSSPSSSSS SATSSSSSSG  180
PSSPLWLSSV SELLDEPMVN KKQKKTKKNV WKIAGQTQTQ TQTQTRRCNH CGVQKTPQWR  240
AGPSGAKTLC NACGVRYKSG RLLPEYRPAC SPTFSSELHS NHHRKVIEMR RKKETSEEAD  300
EITGLNQTVQ VVPSF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00404DAPTransfer from AT3G51080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291312.11e-180hypothetical protein CARUB_v10017445mg
SwissprotQ9SD381e-130GATA6_ARATH; GATA transcription factor 6
TrEMBLR0HGE91e-180R0HGE9_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50012131e-131(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.11e-108GATA transcription factor 6